| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DEC2/SHARP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DEC2/SHARP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DEC2/SHARP1. This antibody reacts with human. The DEC2/SHARP1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DEC2/SHARP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PFCLPFCFLSPSAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLY |
|---|
| Other Names | basic helix-loop-helix domain containing, class B, 3, basic helix-loop-helix family, member e41, bHLHb3, BHLHB3class E basic helix-loop-helix protein 41, bHLHe41, Class B basic helix-loop-helix protein 3, DEC2Enhancer-of-split and hairy-related protein 1, Differentially expressed in chondrocytes protein 2, SHARP-1, SHARP1hDEC2 |
|---|
| Gene, Accession # | BHLHE41, Gene ID: 79365 |
|---|
| Catalog # | NBP2-58737 |
|---|
| Price | |
|---|
| Order / More Info | DEC2/SHARP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|