| 产品详情 |
| Edit |   |
| Antigenic Specificity | DECR1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DECR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DECR1. This antibody reacts with human. The DECR1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DECR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKT |
| Other Names | 2,4-dienoyl CoA reductase 1, mitochondrial, 4-enoyl-CoA reductase, 4-enoyl-CoA reductase [NADPH], DECR, DECR2,4-dienoyl-CoA reductase [NADPH]2,4-dienoyl-CoA reductase, mitochondrial, EC 1.3.1.34, NADPH, SDR18C1, short chain dehydrogenase/reductase family 18C, member 1 |
| Gene, Accession # | DECR1, Gene ID: 1666 |
| Catalog # | NBP1-85263 |
| Price | |
| Order / More Info | DECR1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|