| Edit |   |
| Antigenic Specificity | CAPSL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CAPSL Antibody from Novus Biologicals is a rabbit polyclonal antibody to CAPSL. This antibody reacts with rat. The CAPSL Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human CapslThe immunogen for this antibody is Capsl. Peptide sequence HHPKYQNGEWTEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASID. |
| Other Names | calcyphosine-like, calcyphosin-like protein, MGC26610 |
| Gene, Accession # | CAPSL, Gene ID: 133690, Accession: NP_001099887 |
| Catalog # | NBP1-79507 |
| Price | |
| Order / More Info | CAPSL Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |