| Edit |   |
|---|
| Antigenic Specificity | ASB7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ASB7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ASB7. This antibody reacts with human. The ASB7 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ASB7 (ankyrin repeat and SOCS box-containing 7) The peptide sequence was selected from the middle region of ASB7)(50ug). Peptide sequence QTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPC. |
|---|
| Other Names | ankyrin repeat and SOCS box containing 7, ankyrin repeat and SOCS box protein 7, ankyrin repeat and SOCS box-containing 7, ASB-7, FLJ22551, FLJ25192 |
|---|
| Gene, Accession # | ASB7, Gene ID: 140460, Accession: Q9H672, SwissProt: Q9H672 |
|---|
| Catalog # | NBP1-57599-20ul |
|---|
| Price | |
|---|
| Order / More Info | ASB7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29630609 |
|---|