| Edit |   |
| Antigenic Specificity | ASB5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ASB5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ASB5. This antibody reacts with human. The ASB5 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ASB5(ankyrin repeat and SOCS box-containing 5) The peptide sequence was selected from the C terminal of ASB5. Peptide sequence LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC. |
| Other Names | ankyrin repeat and SOCS box containing 5, ankyrin repeat and SOCS box protein 5, ankyrin repeat and SOCS box-containing 5, ASB-5, SOCS box protein ASB-5 |
| Gene, Accession # | ASB5, Gene ID: 140458, Accession: Q8WWX0, SwissProt: Q8WWX0 |
| Catalog # | NBP1-59065 |
| Price | |
| Order / More Info | ASB5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |