| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Monoamine Oxidase B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Monoamine Oxidase B Antibody from Novus Biologicals is a rabbit polyclonal antibody to Monoamine Oxidase B. This antibody reacts with human, mouse. The Monoamine Oxidase B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to MAOB(monoamine oxidase B) The peptide sequence was selected from the N terminal of MAOB. Peptide sequence RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV. |
|---|
| Other Names | adrenalin oxidase, amine oxidase [flavin-containing] B, EC 1.4.3, EC 1.4.3.4, MAO, brain, MAO, platelet, MAO-B, MGC26382, monoamine oxidase B, Monoamine oxidase type B, tyramine oxidase |
|---|
| Gene, Accession # | MAOB, Gene ID: 4129, Accession: P27338, SwissProt: P27338 |
|---|
| Catalog # | NBP1-59569 |
|---|
| Price | |
|---|
| Order / More Info | Monoamine Oxidase B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26841904 |
|---|
| 产品资料 |
|
|