| 产品详情 |
| Edit |   |
| Antigenic Specificity | PTPN4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PTPN4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PTPN4. This antibody reacts with human. The PTPN4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PTPN4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFL |
| Other Names | EC 3.1.3.48, MEG, megakaryocyte phosphatase, megakaryocyte protein-tyrosine phosphatase, protein tyrosine phosphatase MEG1, protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte), Protein-tyrosine phosphatase MEG1, PTPase-MEG1, PTPMEG, PTPMEG1, tyrosine-protein phosphatase non-receptor type 4 |
| Gene, Accession # | PTPN4, Gene ID: 5775, Accession: P29074 |
| Catalog # | NBP1-80867 |
| Price | |
| Order / More Info | PTPN4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|