| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PTP gamma/PTPRG |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PTP gamma/PTPRG Antibody from Novus Biologicals is a rabbit polyclonal antibody to PTP gamma/PTPRG. This antibody reacts with human. The PTP gamma/PTPRG Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PTP gamma/PTPRG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALHENRHGSAVQIRRRKASGDPYWAYSGAYGPEHWVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLKDDYFVS |
|---|
| Other Names | EC 3.1.3.48, H_RG317H01.1, HPTPG, protein tyrosine phosphatase, receptor type, G, protein tyrosine phosphatase, receptor type, gamma polypeptide, Protein-tyrosine phosphatase gamma, PTPGprotein tyrosine phosphatase gamma, receptor type protein tyrosine phosphatase gamma, receptor tyrosine phosphatase gamma, receptor-type protein phosphatase gamma, receptor-type tyrosine-protein phosphatase gamma, RPTPG, R-PTP-GAMMA |
|---|
| Gene, Accession # | PTPRG, Gene ID: 5793 |
|---|
| Catalog # | NBP2-57477 |
|---|
| Price | |
|---|
| Order / More Info | PTP gamma/PTPRG Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|