| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IPPK |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IPPK Antibody from Novus Biologicals is a rabbit polyclonal antibody to IPPK. This antibody reacts with human, mouse, rat. The IPPK Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat IPPK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GCLLYKTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQKLLDLSTEDDGTVAFALTKVQQYR |
|---|
| Other Names | bA476B13.1, bA476B13.1 (novel protein), C9orf12, chromosome 9 open reading frame 12, EC 2.7.1.158, FLJ13163, inositol 13,45,6-pentakisphosphate 2-kinase, Inositol-13,45,6-pentakisphosphate 2-kinase, inositol-pentakisphosphate 2-kinase, Ins(13,45,6)P5 2-kinase, InsP5 2-kinase, INSP5K2, IP5K, IPK1, IPK1 homolog, KIAA0699 |
|---|
| Gene, Accession # | IPPK, Gene ID: 64768 |
|---|
| Catalog # | NBP1-86712 |
|---|
| Price | |
|---|
| Order / More Info | IPPK Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|