| Edit |   |
|---|
| Antigenic Specificity | IPP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IPP Antibody from Novus Biologicals is a rabbit polyclonal antibody to IPP. This antibody reacts with human. The IPP Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to IPP(intracisternal A particle-promoted polypeptide) The peptide sequence was selected from the C terminal of IPP (NP_005888). Peptide sequence EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAAL. |
|---|
| Other Names | actin-binding protein IPP, intracisternal A particle-promoted polypeptideKLHL27Kelch-like protein 27 |
|---|
| Gene, Accession # | IPP, Gene ID: 3652, Accession: Q9Y573, SwissProt: Q9Y573 |
|---|
| Catalog # | NBP1-56903 |
|---|
| Price | |
|---|
| Order / More Info | IPP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|