| Edit |   |
|---|
| Antigenic Specificity | IPP |
|---|
| Clone | 4C2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IPP Antibody (4C2) from Novus Biologicals is a mouse monoclonal antibody to IPP. This antibody reacts with human. The IPP Antibody (4C2) has been validated for the following applications: ELISA. |
|---|
| Immunogen | IPP (NP_005888.1, 105 a.a. - 204 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NNVQELIIAADMLQLTEVVHLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEFSENYIHVHFLEVHSGEEFLALTKDQLIKILRSEELSIEDEYQVFLAA |
|---|
| Other Names | actin-binding protein IPP, intracisternal A particle-promoted polypeptideKLHL27Kelch-like protein 27 |
|---|
| Gene, Accession # | IPP, Gene ID: 3652, Accession: NP_005888.1, SwissProt: NP_005888.1 |
|---|
| Catalog # | H00003652-M01 |
|---|
| Price | |
|---|
| Order / More Info | IPP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|