| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AGPAT9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AGPAT9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AGPAT9. This antibody reacts with human. The AGPAT9 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human AGPAT9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ILVKTLEWATIRIEKGTPKESILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTN |
|---|
| Other Names | 1-acylglycerol-3-phosphate O-acyltransferase 9, acyl-CoA:glycerol-3-phosphate acyltransferase 3, glycerol-3-phosphate acyltransferase 3, GPAT3, GPAT-3,1-acylglycerol-3-phosphate O-acyltransferase 8, hGPAT3, HMFN0839,1-AGP acyltransferase 9, lysophosphatidic acid acyltransferase theta, MAG1, MAG-1, MGC11324, theta, UNQ2753/PRO6492 |
|---|
| Gene, Accession # | AGPAT9, Gene ID: 84803, Accession: Q53EU6, SwissProt: Q53EU6 |
|---|
| Catalog # | NBP1-93692 |
|---|
| Price | |
|---|
| Order / More Info | AGPAT9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|