| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AGPAT7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AGPAT7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AGPAT7. This antibody reacts with human. The AGPAT7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human AGPAT7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HLLLGSPHPAATALHAELCQAGSSQGLSLCQFQNFSLHDPLYGKLFSTYLRPPHTSRGTSQTPNASSPGNPTALANGTVQAPKQ |
|---|
| Other Names | acyltransferase like 3, Acyltransferase-like 3, AGPAT7acyl-CoA:lysophosphatidylethanolamine acyltransferase 2, AYTL3lysophospholipid acyltransferase LPCAT4,1-acylglycerol-3-phosphate O-acyltransferase 7 (lysophosphatidic acidacyltransferase, eta), EC 2.3.1, EC 2.3.1.-, EC 2.3.1.23, FLJ10257,1-acylglycerol-3-phosphate O-acyltransferase 7, LPAAT-eta, LPEAT21-AGPAT 7, lysophosphatidylcholine acyltransferase 41-AGP acyltransferase 7, Lysophosphatidylethanolamine acyltransferase 2, PLSC domain containing protein |
|---|
| Gene, Accession # | LPCAT4, Gene ID: 254531, Accession: Q643R3, SwissProt: Q643R3 |
|---|
| Catalog # | NBP1-90210 |
|---|
| Price | |
|---|
| Order / More Info | AGPAT7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|