| 产品详情 |
| Edit |   |
| Antigenic Specificity | INTS11 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. ICC/IF reactivity reported in (PMID: 23435261). |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The INTS11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to INTS11. This antibody reacts with human. The INTS11 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human INTS11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKG |
| Other Names | cleavage and polyadenylation specific factor 3-like, Cleavage and polyadenylation-specific factor 3-like protein, CPSF3-like protein, EC 3.1.27, EC 3.1.27.-, FLJ20542, INT11, integrator complex subunit 11, INTS11FLJ13294, Protein related to CPSF subunits of 68 kDa, RC68, RC-68CPSF73L, related to CPSF subunits 68 kDa |
| Gene, Accession # | CPSF3L, Gene ID: 54973 |
| Catalog # | NBP1-85475 |
| Price | |
| Order / More Info | INTS11 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23435261 |
| 产品资料 |
|
|