| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Als2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Als2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Als2. This antibody reacts with human. The Als2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Als2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FQPGLYYSGRQDPTEGDNLPENHSGSKTPVLLSCSKLGYISRVTAGKDSY LALVDKNIMGYIASLHELATTERRFYSKLSD |
|---|
| Other Names | ALS2CR6, alsin, ALSJ, amyotrophic lateral sclerosis 2 (juvenile), amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 6, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 6 protein, Amyotrophic lateral sclerosis 2 protein, FLJ31851, IAHSP, KIAA1563, MGC87187, PLSJ |
|---|
| Gene, Accession # | ALS2, Gene ID: 57679 |
|---|
| Catalog # | NBP2-14284 |
|---|
| Price | |
|---|
| Order / More Info | Als2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29469808 |
|---|
| 产品资料 |
|
|