| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ALPPL2 |
|---|
| Clone | 2B3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunoprecipitation, Immunohistochemistry-Paraffin, RNA Inhibition. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ALPPL2 Antibody (2B3) from Novus Biologicals is a mouse monoclonal antibody to ALPPL2. This antibody reacts with human. The ALPPL2 Antibody (2B3) has been validated for the following applications: Western Blot, ELISA, Immunoprecipitation, Immunohistochemistry-Paraffin, RNA Inhibition. |
|---|
| Immunogen | ALPPL2 (NP_112603 365 a.a. - 454 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGE |
|---|
| Other Names | Alkaline phosphatase Nagao isozyme, alkaline phosphatase, placental-like, alkaline phosphatase, placental-like 2, ALP-1, ALPG, ALPPL, EC 3.1.3.1, GCAP, Germ cell alkaline phosphatase, Nagao isozyme, Placental alkaline phosphatase-like, placental-like alkaline phosphatase, PLAP-like, testicular and thymus alkaline phosphatase |
|---|
| Gene, Accession # | ALPPL2, Gene ID: 251, Accession: NP_112603, SwissProt: NP_112603 |
|---|
| Catalog # | H00000251-M07 |
|---|
| Price | |
|---|
| Order / More Info | ALPPL2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|