Edit |   |
Antigenic Specificity | Fatty Acid Amide Hydrolase 2 (FAAH2) (C-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Fatty acid amide hydrolases, such as FAAH1 and FAAH2, hydrolyze primary fatty acid amide substrates and may play a role in fatty acid catabolism. |
Immunogen | FAAH2 antibody was raised using the C terminal of FAAH2 corresponding to a region with amino acids SPLWELIKWCLGLSVYTIPSIGLALLEEKLRYSNEKYQKFKAVEESLRKE |
Other Names | AMDD |
Gene, Accession # | Gene ID: 158584 |
Catalog # | ABIN636114 |
Price | |
Order / More Info | Fatty Acid Amide Hydrolase 2 (FAAH2) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |