| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 37 (Glycerol-3-Phosphate Transporter), Member 3 (SLC37A3) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC17A3 may be involved in actively transporting phosphate into cells via Na(+) cotransport. |
|---|
| Immunogen | SLC37 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDS |
|---|
| Other Names | 2610507O21Rik|AU044904 |
|---|
| Gene, Accession # | Gene ID: 84255 |
|---|
| Catalog # | ABIN635164 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 37 (Glycerol-3-Phosphate Transporter), Member 3 (SLC37A3) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|