| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC32A1 is involved in the uptake of GABA and glycine into the synaptic vesicles. |
|---|
| Immunogen | SLC32 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWE |
|---|
| Other Names | CG8394|CG8394.2|Dmel\\CG8394|VIAAT|vGAT|Ci-vGAT|slc32a1|viaat|MGC68938|vgat|xVIAAT|VGAT|Vgat|Viaat|R75019|BGT1|Gat1|RNU28927 |
|---|
| Gene, Accession # | Gene ID: 140679 |
|---|
| Catalog # | ABIN635012 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|