| 产品详情 |
| Edit |   |
| Antigenic Specificity | SCUBE3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SCUBE3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SCUBE3. This antibody reacts with human. The SCUBE3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SCUBE3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLSIKQRASFKIKDAKCRLHLRNKGKTEEAGRITGPGGAPCSECQVTFIHLKCDSSRKGKGRRARTPPGKEVTRLTLELEAEVRAEETTAS |
| Other Names | CEGF3, CUB and EGF containing protein 3, CUB domain and EGF-like repeat containing 3, DKFZp686B09105, DKFZp686B1223, DKFZp686D20108, FLJ34743, signal peptide, CUB and EGF-like domain containing protein 3, signal peptide, CUB and EGF-like domain-containing protein 3, signal peptide, CUB domain, EGF-like 3 |
| Gene, Accession # | SCUBE3, Gene ID: 222663 |
| Catalog # | NBP1-85692 |
| Price | |
| Order / More Info | SCUBE3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|