| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 22 Member 16 (SLC22A16) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs). |
|---|
| Immunogen | SLC22 A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR |
|---|
| Other Names | slc22a16|4921504E14Rik|CT2|FLIPT2|OCT6|OKB1|OAT6|dJ261K5.1 |
|---|
| Gene, Accession # | Gene ID: 85413 |
|---|
| Catalog # | ABIN630397 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 22 Member 16 (SLC22A16) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|