Edit |   |
Antigenic Specificity | DPH2 Homolog (S. Cerevisiae) (DPH2) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. This gene is one of two human genes similar to the yeast gene dph2. |
Immunogen | DPH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CLSPPARPLPVAFVLRQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAH |
Other Names | DPH2L2|9130020C19Rik|AI467389|Dph2l2|id:ibd5058|zgc:162269 |
Gene, Accession # | Gene ID: 1802 |
Catalog # | ABIN631965 |
Price | |
Order / More Info | DPH2 Homolog (S. Cerevisiae) (DPH2) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |