Edit |   |
Antigenic Specificity | DPH1 Homolog (S. Cerevisiae) (DPH1) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 . This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. |
Immunogen | DPH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NQIPPEILKNPQLQAAIRVLPSNYNFEIPKTIWRIQQAQAKKVALQMPEG |
Other Names | DPH1|DPH1-OVCA2|dph1-ovca2|dph2l|dph2l1|ovca1|DPH2L|DPH2L1|OVCA1|zgc:110702|2310011M22Rik|4930488F09Rik|AW551873|Dph2l1|Ovca1|RGD1562694 |
Gene, Accession # | Gene ID: 1801 |
Catalog # | ABIN632548 |
Price | |
Order / More Info | DPH1 Homolog (S. Cerevisiae) (DPH1) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |