| Edit |   |
|---|
| Antigenic Specificity | VMO1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval method is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VMO1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VMO1. This antibody reacts with human. The VMO1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human VMO1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPL |
|---|
| Other Names | ERGA6350, MGC125880, MGC125881, PRO21055, vitelline membrane outer layer 1 homolog (chicken), vitelline membrane outer layer protein 1 homolog |
|---|
| Gene, Accession # | VMO1, Gene ID: 284013, Accession: Q7Z5L0, SwissProt: Q7Z5L0 |
|---|
| Catalog # | NBP1-92574 |
|---|
| Price | |
|---|
| Order / More Info | VMO1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|