Edit |   |
Antigenic Specificity | Calcium Homeostasis Endoplasmic Reticulum Protein (CHERP) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | CHERP is involved in calcium homeostasis, growth and proliferation. |
Immunogen | CHERP antibody was raised using the middle region of CHERP corresponding to a region with amino acids EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD |
Other Names | cherp|MGC53695|CHERP|DAN16|SCAF6|SRA1|ik:tdsubc_2h12|scaf6|wu:fc83d01|xx:tdsubc_2h12|zgc:55518|5730408I11Rik|D8Wsu96e|Scaf6 |
Gene, Accession # | Gene ID: 10523,27967,290614 |
Catalog # | ABIN633834 |
Price | |
Order / More Info | Calcium Homeostasis Endoplasmic Reticulum Protein (CHERP) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |