| Edit |   |
|---|
| Antigenic Specificity | Calcium Channel, Voltage-Dependent, beta 1 Subunit (CACNB1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CACNB1 belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. |
|---|
| Immunogen | CACNB1 antibody was raised using the N terminal of CACNB1 corresponding to a region with amino acids DWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLGSSKSGDNSSS |
|---|
| Other Names | CACNB1|zgc:91982|CAB1|CACNLB1|CCHLB1|Cchb1|Cchlb1 |
|---|
| Gene, Accession # | Gene ID: 782 |
|---|
| Catalog # | ABIN633641 |
|---|
| Price | |
|---|
| Order / More Info | Calcium Channel, Voltage-Dependent, beta 1 Subunit (CACNB1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|