| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Calcium Channel, Voltage-Dependent, beta 4 Subunit (CACNB4) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CACNB4 is a member of the beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. CACNB4 plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Certain mutations in this gene have been associated with idiopathic generalized epilepsy (IGE) and juvenile myoclonic epilepsy (JME). |
|---|
| Immunogen | CACNB4 antibody was raised using the middle region of CACNB4 corresponding to a region with amino acids GVPDPGTGASSGTRTPDVKAFLESPWSLDPASASPEPVPHILASSRQWDP |
|---|
| Other Names | CACNB4|CAB4|CACNLB4|EA5|EIG9|EJM|EJM4|EJM6|3110038O15Rik|Cchb4|lethargic|lh |
|---|
| Gene, Accession # | Gene ID: 785 |
|---|
| Catalog # | ABIN633638 |
|---|
| Price | |
|---|
| Order / More Info | Calcium Channel, Voltage-Dependent, beta 4 Subunit (CACNB4) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|