Edit |   |
Antigenic Specificity | Calcium Channel, Voltage-Dependent, beta 1 Subunit (CACNB1) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The protein encoded by CACNB1 belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. |
Immunogen | CACNB1 antibody was raised using the middle region of CACNB1 corresponding to a region with amino acids TRRPTPPASGNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPP |
Other Names | CACNB1|zgc:91982|CAB1|CACNLB1|CCHLB1|Cchb1|Cchlb1 |
Gene, Accession # | Gene ID: 782 |
Catalog # | ABIN633644 |
Price | |
Order / More Info | Calcium Channel, Voltage-Dependent, beta 1 Subunit (CACNB1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |