| Edit |   |
|---|
| Antigenic Specificity | Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CACNB2 is a subunit of voltage-dependent calcium (Ca2+) channels, expressed in the CNS. It appears to serve an obligatory function. |
|---|
| Immunogen | CACNB2 antibody was raised using the C terminal of CACNB2 corresponding to a region with amino acids RQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDH |
|---|
| Other Names | Cacnb2|CACNB2|CACNLB2|CAVB2|MYSB|CAB2|AW060387|Cavbeta2|Cchb2|Cacnlb2 |
|---|
| Gene, Accession # | Gene ID: 783 |
|---|
| Catalog # | ABIN633669 |
|---|
| Price | |
|---|
| Order / More Info | Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|