| 产品详情 |
| Edit |   |
| Antigenic Specificity | SPATS2L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SPATS2L Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPATS2L. This antibody reacts with human. The SPATS2L Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SPATS2L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EPSKALRGVTEGNRLLQQKLSLDGNPKPIHGTTERSDGLQWSAEQPCNPSKPKAKTSPVKSNTPAAHLEIKPDELAKKR |
| Other Names | DKFZp564A2416, DNA polymerase transactivated protein 6, DNA polymerase-transactivated protein 6, DNAPTP6SGNP, SPATS2-like protein, spermatogenesis associated, serine-rich 2-like, stress granule and nucleolar protein |
| Gene, Accession # | SPATS2L, Gene ID: 26010, Accession: Q9NUQ6, SwissProt: Q9NUQ6 |
| Catalog # | NBP2-31605 |
| Price | |
| Order / More Info | SPATS2L Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|