Edit |   |
Antigenic Specificity | Endophilin-A1 (SH3G2) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | SH3GL2 is implicated in synaptic vesicle endocytosis. SH3GL2 may recruit other proteins to membranes with high curvature. |
Immunogen | SH3 GL2 antibody was raised using the middle region of SH3 L2 corresponding to a region with amino acids PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD |
Other Names | CNSA2|EEN-B1|SH3D2A|SH3P4|9530001L19Rik|AI120490|AW555077|B930049H17Rik|SH3PA|Sh3d2a|Sh3p4 |
Gene, Accession # | Gene ID: 6456,20404 |
Catalog # | ABIN633831 |
Price | |
Order / More Info | Endophilin-A1 (SH3G2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |