| Edit |   |
| Antigenic Specificity | C1orf159/RIVIG |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C1orf159/RIVIG Antibody from Novus Biologicals is a rabbit polyclonal antibody to C1orf159/RIVIG. This antibody reacts with human. The C1orf159/RIVIG Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human C1orf159. Peptide sequence PLPGSPGDPPTRQGQGRIWLVPPALDLSWIWPAPPARPPLIPVTSMLFPV. |
| Other Names | chromosome 1 open reading frame 159, RP11-465B22.4 |
| Gene, Accession # | C1ORF159, Gene ID: 54991, Accession: CAI14318, SwissProt: CAI14318 |
| Catalog # | NBP1-91308 |
| Price | |
| Order / More Info | C1orf159/RIVIG Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |