| Edit |   |
|---|
| Antigenic Specificity | BTN1A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | BTN1A1 antibody. Specificity: BTN1A1 antibody was raised against the N terminal of BTN1A1 |
|---|
| Immunogen | BTN1A1 antibody was raised using the N terminal of BTN1A1 corresponding to a region with amino acids LPCRLSPNASAEHLELRWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATL |
|---|
| Other Names | butyrophilin subfamily 1 member A1; Butyrophilin subfamily 1 member A1; butyrophilin subfamily 1 member A1; butyrophilin, subfamily 1, member A1, BTN1A1; BTN1A1; BT; BTN; BTN1; BTN; BT |
|---|
| Gene, Accession # | BTN1A1, Gene ID: 696, NCBI: NP_001723.2 |
|---|
| Catalog # | MBS839796 |
|---|
| Price | |
|---|
| Order / More Info | BTN1A1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|