| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Endosialin/CD248/TEM1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Endosialin/CD248/TEM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Endosialin/CD248/TEM1. This antibody reacts with human. The Endosialin/CD248/TEM1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Endosialin/CD248/TEM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EEDEDEAWKAFNGGWTEMPGILWMEPTQPPDFALAYRPSFPEDREPQIPY PEPTWPPPLSAPRVPYHSSVLSVTRPVVVSATH |
|---|
| Other Names | 2610111G01Rik, CD164 sialomucin-like 1, CD164L1, CD248 antigen, CD248 antigen, endosialin, CD248 molecule, endosialin, endosialin, MGC119479, TEM1MGC119478, Tumor endothelial marker 1 |
|---|
| Gene, Accession # | CD248, Gene ID: 57124 |
|---|
| Catalog # | NBP2-14462 |
|---|
| Price | |
|---|
| Order / More Info | Endosialin/CD248/TEM1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26300407 |
|---|
| 产品资料 |
|
|