| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GPCR LGR8/RXFP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | unconjugated |
|---|
| Size | 100ug |
|---|
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
|---|
| Applications | Flow Cytometry, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for GPCR LGR8 detection. Tested with WB, FCM in Human. No cross reactivity with other proteins. Relaxin/insulin-like family peptide receptor 2, also known as RXFP2, is a human G-protein coupled receptor. It is mapped to 13q13.1. This gene encodes a member of the GPCR (G protein-coupled, 7-transmembrane receptor) family. Mutations in this gene are associated with cryptorchidism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of human GPCR LGR8 (MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ). |
|---|
| Other Names | Relaxin receptor 2; G-protein coupled receptor 106; G-protein coupled receptor affecting testicular descent; Leucine-rich repeat-containing G-protein coupled receptor 8; Relaxin family peptide receptor 2; RXFP2; GPR106; GREAT; LGR8 |
|---|
| Gene, Accession # | RXFP2, UniProt: Q8WXD0 |
|---|
| Catalog # | A04848-1 |
|---|
| Price | |
|---|
| Order / More Info | GPCR LGR8/RXFP2 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|