| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Annexin A4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, porcine |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Annexin A4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Annexin A4. This antibody reacts with human, porcine. The Annexin A4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to ANXA4 (annexin A4) The peptide sequence was selected from the N terminal of ANXA4. Peptide sequence GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ. |
|---|
| Other Names | annexin A4, Annexin IV, annexin IV (placental anticoagulant protein II), annexin-4, ANX4Carbohydrate-binding protein p33/p41, Chromobindin-4, chromobindin-4,35-beta calcimedin, DKFZp686H02120, Endonexin I, Lipocortin IV, MGC75105, P32.5, PAP-II, PIG28, Placental anticoagulant protein II, PP4-X, proliferation-inducing gene 28, proliferation-inducing protein 28, Protein II, ZAP36 |
|---|
| Gene, Accession # | ANXA4, Gene ID: 307, Accession: Q6LES2, SwissProt: Q6LES2 |
|---|
| Catalog # | NBP1-59120 |
|---|
| Price | |
|---|
| Order / More Info | Annexin A4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25976747 |
|---|
| 产品资料 |
|
|