| Edit |   |
|---|
| Antigenic Specificity | AGMO |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AGMO Antibody from Novus Biologicals is a rabbit polyclonal antibody to AGMO. This antibody reacts with human. The AGMO Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TMEM195 (transmembrane protein 195) The peptide sequence was selected from the middle region of TMEM195)(50ug). Peptide sequence AGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALFIPPSVYAVHLQF. |
|---|
| Other Names | alkylglycerol monooxygenase, transmembrane protein 195 |
|---|
| Gene, Accession # | AGMO, Gene ID: 392636 |
|---|
| Catalog # | NBP1-70404-20ul |
|---|
| Price | |
|---|
| Order / More Info | AGMO Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|