| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD69 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD69 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD69. This antibody reacts with human. The CD69 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSE |
|---|
| Other Names | Activation inducer molecule, activation inducer molecule (AIM/CD69), AIM, BL-AC/P26, CD69 antigen, CD69 antigen (p60, early T-cell activation antigen), CD69 molecule, CLEC2CC-type lectin domain family 2 member C, C-type lectin domain family 2, member C, EA1, early activation antigen CD69, early lymphocyte activation antigen, Early T-cell activation antigen p60, GP32/28, Leukocyte surface antigen Leu-23, MLR-3 |
|---|
| Gene, Accession # | CD69, Gene ID: 969, Accession: Q07108, SwissProt: Q07108 |
|---|
| Catalog # | NBP2-37926-25ul |
|---|
| Price | |
|---|
| Order / More Info | CD69 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|