| Edit |   |
|---|
| Antigenic Specificity | COX7A2L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The COX7A2L Antibody from Novus Biologicals is a rabbit polyclonal antibody to COX7A2L. This antibody reacts with human. The COX7A2L Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human COX7A2L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVY |
|---|
| Other Names | COX7ARcytochrome c oxidase subunit VII-related protein, COX7a-related protein, COX7RPmitochondrial, cytochrome c oxidase subunit VIIa polypeptide 2 like, Cytochrome c oxidase subunit VIIa-related protein, estrogen receptor binding CpG island, SIG81 |
|---|
| Gene, Accession # | COX7A2L, Gene ID: 9167 |
|---|
| Catalog # | NBP2-56202 |
|---|
| Price | |
|---|
| Order / More Info | COX7A2L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|