| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TTC7B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TTC7B Antibody from Novus Biologicals is a rabbit polyclonal antibody to TTC7B. This antibody reacts with human. The TTC7B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TTC7B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SECQWERIPELVKQLSAKLIANDDMAELLLGESKLEQYLKEHPLRQGASPRGPKPQLTEVRKHLTAALDRGNLKSEFLQESNLIMAKLNYVEGDY |
|---|
| Other Names | c14_5685, tetratricopeptide repeat domain 7 like 1, tetratricopeptide repeat domain 7B, tetratricopeptide repeat protein 7B, Tetratricopeptide repeat protein 7-like-1, TPR repeat protein 7B, TPR repeat protein 7-like-1, TTC7L1 |
|---|
| Gene, Accession # | TTC7B, Gene ID: 145567, Accession: Q86TV6, SwissProt: Q86TV6 |
|---|
| Catalog # | NBP2-31715 |
|---|
| Price | |
|---|
| Order / More Info | TTC7B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|