| 产品详情 |
| Edit |   |
| Antigenic Specificity | TTC21B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, zebrafish |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TTC21B Antibody from Novus Biologicals is a rabbit polyclonal antibody to TTC21B. This antibody reacts with human, zebrafish. The TTC21B Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TTC21B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ALAHEPVNELSALMEDGRCQVLLAKVYSKMEKLGDAITALQQARELQARVLKRVQMEQPDAVPAQKHLAAEICAEIAKHSVAQRDYE |
| Other Names | ATD4, JBTS11, KIAA1992, putative protein product of Nbla10696, tetratricopeptide repeat domain 21B, tetratricopeptide repeat protein 21B, THM1, TPR repeat protein 21B |
| Gene, Accession # | TTC21B, Gene ID: 79809 |
| Catalog # | NBP1-90416 |
| Price | |
| Order / More Info | TTC21B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 25860617 |
| 产品资料 |
|
|