| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TIP30 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TIP30 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TIP30. This antibody reacts with human. The TIP30 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TIP30 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFC |
|---|
| Other Names | 30 kDa HIV-1 TAT-interacting protein, CC3oxidoreductase HTATIP2, EC 1.1.1, EC 1.1.1.-, FLJ26963, HIV-1 Tat interactive protein 2, 30 kDa, HIV-1 Tat interactive protein 2, 30kDa, HIV-1 TAT-interactive protein 2, SDR44U1, Tat-interacting protein (30kD), TIP30short chain dehydrogenase/reductase family 44U, member 1 |
|---|
| Gene, Accession # | HTATIP2, Gene ID: 10553 |
|---|
| Catalog # | NBP1-88170 |
|---|
| Price | |
|---|
| Order / More Info | TIP30 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|