| Edit |   |
|---|
| Antigenic Specificity | Phenazine Biosynthesis-Like Protein Domain Containing (PBLD) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of the PBLD protein has not been widely studied, and is yet to be fully elucidated. |
|---|
| Immunogen | PBLD antibody was raised using the N terminal of PBLD corresponding to a region with amino acids KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIR |
|---|
| Other Names | MAWBP|MAWDBP|0610038K03Rik|Mawbp|Pbld |
|---|
| Gene, Accession # | Gene ID: 64081 |
|---|
| Catalog # | ABIN632880 |
|---|
| Price | |
|---|
| Order / More Info | Phenazine Biosynthesis-Like Protein Domain Containing (PBLD) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|