| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NME5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NME5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NME5. This antibody reacts with human. The NME5 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human NME5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI |
|---|
| Other Names | Inhibitor of p53-induced apoptosis-beta, IPIA-beta, NDK-H 5, NDP kinase homolog 5, nm23-H5, NM23H5, non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase), nucleoside diphosphate kinase homolog 5, radial spoke 23 homolog, RSPH23, Testis-specific nm23 homolog |
|---|
| Gene, Accession # | NME5, Gene ID: 8382 |
|---|
| Catalog # | NBP2-58388 |
|---|
| Price | |
|---|
| Order / More Info | NME5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|