| 产品详情 |
| Edit |   |
| Antigenic Specificity | NME5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NME5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NME5. This antibody reacts with human. The NME5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NME5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI |
| Other Names | Inhibitor of p53-induced apoptosis-beta, IPIA-beta, NDK-H 5, NDP kinase homolog 5, nm23-H5, NM23H5, non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase), nucleoside diphosphate kinase homolog 5, radial spoke 23 homolog, RSPH23, Testis-specific nm23 homolog |
| Gene, Accession # | NME5, Gene ID: 8382 |
| Catalog # | NBP1-92188 |
| Price | |
| Order / More Info | NME5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|