| 产品详情 |
| Edit |   |
| Antigenic Specificity | Eg5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Eg5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Eg5. This antibody reacts with human. The Eg5 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Eg5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIVELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVK |
| Other Names | Eg5, HKSP, kinesin family member 11, kinesin-like 1, Kinesin-like protein 1, kinesin-like protein KIF11, Kinesin-like spindle protein HKSP, Kinesin-related motor protein Eg5, KNSL1TRIP-5, thyroid receptor interacting protein 5, Thyroid receptor-interacting protein 5, TR-interacting protein 5, TRIP5EG5 |
| Gene, Accession # | KIF11, Gene ID: 3832 |
| Catalog # | NBP2-58929 |
| Price | |
| Order / More Info | Eg5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|