| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PTP-MEG2/PTPN9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PTP-MEG2/PTPN9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PTP-MEG2/PTPN9. This antibody reacts with human. The PTP-MEG2/PTPN9 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PTP-MEG2/PTPN9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LATWNFQFLPQVNGHPDPFDEIILFSLPPALDWDSVHVPGPHAMTIQELVDYVNARQKQGIYEEYEDIRRENPVGTFHCSMSPGNL |
|---|
| Other Names | EC 3.1.3.48, MEG2, protein tyrosine phosphatase, non-receptor type 9, Protein-tyrosine phosphatase MEG2, PTPase MEG2, PTPase-MEG2, PTPMEG2, tyrosine-protein phosphatase non-receptor type 9 |
|---|
| Gene, Accession # | PTPN9, Gene ID: 5780 |
|---|
| Catalog # | NBP1-81243 |
|---|
| Price | |
|---|
| Order / More Info | PTP-MEG2/PTPN9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|