| 产品详情 |
| Edit |   |
| Antigenic Specificity | TUT1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TUT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TUT1. This antibody reacts with human. The TUT1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TUT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GWLATEAQVTQELKGLSGGEERPETEPLLSFVASVSPADRMLTVTPLQDPQGLFPDLHHFLQVFLPQAIR |
| Other Names | EC 2.7.7.19, EC 2.7.7.52, FLJ21850, FLJ22267, FLJ22347, MGC131987, MGC149809, nuclear speckle targeted phosphatidylinositol 4-phosphate 5-kinase type I-alpharegulated-poly(A) polymerase, nuclear speckle-targeted PIPK1A-regulated-poly(A) polymerase, PAP-associated domain-containing 2, PAPD2, poly(A) polymerase associated domain containing 2, RBM21, RNA binding motif protein 21, RNA uridylyltransferase, RNA-binding motif protein 21, RNA-binding protein 21, speckle targeted PIP5K1A-regulated poly(A) polymerase, star-PAP, STARPAP, terminal uridylyl transferase 1, U6 snRNA-specific, TUTase, U6 snRNA-specific terminal uridylyltransferase 1, U6 TUTase, U6-TUTase |
| Gene, Accession # | TUT1, Gene ID: 64852 |
| Catalog # | NBP2-56631 |
| Price | |
| Order / More Info | TUT1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|