| Edit |   |
| Antigenic Specificity | ASPDH |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ASPDH Antibody from Novus Biologicals is a rabbit polyclonal antibody to ASPDH. This antibody reacts with human. The ASPDH Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LOC554235(hypothetical protein LOC554235) The peptide sequence was selected from the N terminal of LOC554235. Peptide sequence VVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHA. |
| Other Names | aspartate dehydrogenase domain containing, Aspartate dehydrogenase domain-containing protein, EC 1.4.1.21, putative L-aspartate dehydrogenase |
| Gene, Accession # | ASPDH, Gene ID: 554235, Accession: A6ND91, SwissProt: A6ND91 |
| Catalog # | NBP1-56824-20ul |
| Price | |
| Order / More Info | ASPDH Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |