| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SPINK1 |
|---|
| Clone | 4D4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. Antibody reactivity against recombinant protein for WB. It has been used for IHC-P, IP and Sandwich ELISA. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 26258891). Use in Immunohistochemistry-Frozen reported in scientific literature (PMID: 29925878). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPINK1 Antibody (4D4) from Novus Biologicals is a mouse monoclonal antibody to SPINK1. This antibody reacts with human. The SPINK1 Antibody (4D4) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. |
|---|
| Immunogen | SPINK1 (AAH25790, 24 a.a. - 79 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC |
|---|
| Other Names | pancreatic secretory trypsin inhibitor, PCTTSpink3, PSTISerine protease inhibitor Kazal-type 1, serine peptidase inhibitor, Kazal type 1, serine protease inhibitor, Kazal type 1, TATITumor-associated trypsin inhibitor |
|---|
| Gene, Accession # | SPINK1, Gene ID: 6690, Accession: AAH25790, SwissProt: AAH25790 |
|---|
| Catalog # | H00006690-M01 |
|---|
| Price | |
|---|
| Order / More Info | SPINK1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 18538735, 19465903, 22944196, 23348902, 23527199, 24687926, 24722062, 25175425, 25809148, 26172920, 26258891, 26437224, 26586397, 27845447, 28631187, 28699202, 29925878 |
|---|
| 产品资料 |
|
|